DPCstruct | MC54262
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 124 ± 14 aa |
| Standard deviation of domain lengths | 14.07 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 36.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G4A031 | 29-150 | SSAFTSRAHLNVMRIDPLDRQTNINTVFHLLSNSLFRNTEDSPPRYIKEIISILRQIDYNNELNIVKNIIEIKRISKMEPAPDENSH… |
| A0A140IV65 | 5-127 | KAQQDMKVKVNVLRIPANEREANIVAVYAILINKDLMGNIDHIPNIIWQIKSIIENINLDDDDDIAKSICSIKEKIKNSNENCTNKN… |
| A0A2S6EWL7 | 85-216 | None |
| A0A0W0YFE9 | 652-770 | None |
| A0A1E5JWN4 | 278-399 | None |
| A0A3S5DKG4 | 610-730 | None |
| A0A5R4SH84 | 331-447 | None |
| A0A378JPE7 | 283-454 | None |
| A0A378J5B2 | 1-115 | None |
| A0A364LGP0 | 533-654 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.