DPCstruct | MC5426
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 178 ± 15 aa |
| Standard deviation of domain lengths | 14.76 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 68.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 51.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0018 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P5RHV8 | 1-153 | MDDGEVGTSDQAVDTFVDECLKNTRTCTHTHTCNPPGPDAARTHTCYHTHTQVLLSEDDDGAKNKEHSVPRPRRRRPSRNREAVRKY… |
| R0FRK3 | 3-158 | MDEEEVQVWDGASRGCSHTHSCNPPGPDDASHSHTCFHTHTHLIIPDQQENDHSDSSNKKRSCGNREAVRKYREKKKARTAYLEDEV… |
| A0A6S7MNL7 | 65-246 | None |
| A0A2R6RA62 | 1-187 | None |
| A0A4Y7J6J8 | 1-185 | None |
| R7WE17 | 14-165 | None |
| A0A022RSM8 | 1-174 | None |
| A0A6A1V464 | 1-185 | None |
| A0A287SVC9 | 1-191 | None |
| A0A6J0KHH5 | 1-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.