DPCstruct | MC54259
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 213 ± 11 aa |
| Standard deviation of domain lengths | 11.23 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0265 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X0W699 | 1-203 | MAKLIDAFVTQVIENSDYTIDDHFYLRNRILALTGEAGANQETARTTLISLRDALVDVAVDNGKVGDLTEERDTLGAALMDFITPAP… |
| A0A380KE28 | 1-236 | MKLLESFVSEIISNSDYTELDVTYLQNRIMTLVGEDNVTAEVATTDLIALKNQLVEVAVGNGRCGHLQEEKNCLGAELMNFITPIPS… |
| A0A084U3F2 | 2-215 | None |
| A0A1H9EQC8 | 384-606 | None |
| A0A7Z2HVG3 | 1-211 | None |
| A0A4L7JTD2 | 219-421 | None |
| A0A133XW71 | 22-246 | None |
| D4YH11 | 1-208 | None |
| A0A845EJH9 | 337-541 | None |
| A0A429ZEQ6 | 1-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.