DPCstruct | MC54255
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 64 ± 7 aa |
| Standard deviation of domain lengths | 6.92 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 36.89 |
| Pfam Score | 97.50 |
| Assigned Pfam label(s) | CL0023- PF08393 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J5ZB14 | 4-61 | TICTIDVHARDVVAKMIAHKVENSQAFVWLSQLRHRWDEKDKHCFSNICDVMFLYSYE |
| A0A6I9NRU9 | 23-78 | LIVIEVHAKEVAAKLVELQVSSINDFEWISQLRYYWTKNDLYIRAVNAEFLYGYEY |
| A0A094ZP70 | 2-62 | None |
| A0A5E4B747 | 854-929 | None |
| A0A2R7WE36 | 4-61 | None |
| A0A5E4AJ27 | 147-201 | None |
| A0A7S1N7H0 | 173-241 | None |
| A0A2V2VJU2 | 44-106 | None |
| A0A1D2MUZ1 | 95-164 | None |
| A0A0L0S005 | 216-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.