DPCstruct | MC54250
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 189 ± 40 aa |
| Standard deviation of domain lengths | 40.07 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 84.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.46 |
| Pfam Score | 88.19 |
| Assigned Pfam label(s) | CL0123- PF20772- PF01709- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N6A8I0 | 18-168 | YEGIGPASSQYVVKAITDNKNRSASNIRHIFSKHGGSLASVMWNFEQKGVIRILKEKLPVLNEDQELELIELGAEDIQKEDEGYTII… |
| A0A7J5YXN7 | 61-255 | HNKWSKVKHIKGPKDAARCKMFMKFALLIKLASKPGSQLTYEVRGPGGCMLLIEALTDNRTGTNHEIKRLLQRTGMISDGVRHNFIR… |
| A0A7R9A3Y1 | 168-383 | None |
| A0A066VMP1 | 1-348 | None |
| A0A449BKQ1 | 210-415 | None |
| A0A1X6PFU6 | 105-324 | None |
| A0A2H0TRA2 | 2-106 | None |
| A0A1R3IVR8 | 436-663 | None |
| A0A2C9JLT4 | 32-233 | None |
| A0A1A9ZXV5 | 222-435 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.