DPCstruct | MC5424
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 105 ± 11 aa |
| Standard deviation of domain lengths | 10.97 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R0EU77 | 23-126 | QVKAETCDDNLGLCKNCDQRCKAKHGPSSVSKCNGPEGTCMCTHECAPAPKLFPAKVCVGAIDMCTDTCPLSCCDRLCAIKYKNGRG… |
| A0A072V5Y6 | 30-126 | IGRCDKANCATHCQSYAKGVAVLGSSCSFYNLCTCAFDRSPPGLDQPACEVGLGLCNAQCSDSCCNTNCVRKYQNLGGVGKCIFAFD… |
| A0A5B6VRC4 | 94-212 | None |
| A0A7J9GEM4 | 119-212 | None |
| A0A6P5XLJ3 | 3-110 | None |
| A0A0B2Q5H5 | 12-113 | None |
| A0A7N0R932 | 4-98 | None |
| A0A5J5NE43 | 1-109 | None |
| A0A251QU36 | 33-154 | None |
| R0F2W6 | 81-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.