DPCstruct | MC54239
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 65 ± 5 aa |
| Standard deviation of domain lengths | 5.45 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 35.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6AU20 | 115-172 | LPPWQLHPEINPLDMFWKMGKGEQELSRFTYYYNSLNNEERRNLESQFPEPRGWAGFY |
| A0A509MQ48 | 2-64 | EGEREPVWVVFPRIPWGSVGWRMGPGEEYWHAWAKWFRELSAEGQQAYQARWPEPDRWRGFYE |
| A0A7W0VHP8 | 79-147 | None |
| A0A328YXN4 | 82-140 | None |
| A0A2A4UFB6 | 33-95 | None |
| A0A7T9SAG4 | 82-142 | None |
| A0A0C1EDX1 | 10-82 | None |
| A0A238KPW6 | 1-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.