DPCstruct | MC54235
Metacluster Properties and Pfam Annotations
| Number of structural domains | 418 |
|---|---|
| Mean domain length (aa) | 152 ± 31 aa |
| Standard deviation of domain lengths | 31.12 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 81.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 15.94 |
| Pfam Score | 97.83 |
| Assigned Pfam label(s) | CL0226- PF12999- PF12414- PF03820 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1YCR6 | 33-173 | TQTIVQRRLESLEPLKSRCLQATEGWWSYEYCHLKYIRQYRKASRSTAKTEGNYFLGKYTNSQNVVDTTLIEGSPNHLSQRWGGGTP… |
| V9ILZ6 | 223-361 | RENFQAAERSVNDLLLEIKKYEEKLNRDFGVEHEFAPLDGECFEFRNVEYIYTLCMFVKATQRSESGGNDVTLGHWNDWSGPEGQKY… |
| A0A7S3ZNW7 | 28-168 | None |
| F4PND7 | 357-476 | None |
| F4PP01 | 115-270 | None |
| F4Q890 | 4-140 | None |
| F4Q702 | 15-177 | None |
| F4QAC0 | 224-348 | None |
| A0A6S8WE68 | 283-401 | None |
| A0A6P8I8W2 | 71-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.