DPCstruct | MC54233
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 198 ± 33 aa |
| Standard deviation of domain lengths | 32.61 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.07 |
| Pfam Score | 97.22 |
| Assigned Pfam label(s) | PF01213- CL0391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1Y7N5 | 9-210 | SLVERLEATAVRLESSYGTNSGAASKESSCMIAYEEILTGALNRFLTNSKQISPIVSEQSLEVQKAFEAQKALILFAIENKKVPLTS… |
| A0A813JDS8 | 2-150 | TAAAKDVGNQDVIEATDFFADGMGLLRELLAATGVCAKPQDTAWQKILGAVMELGTKAQKACDNRSECFQNRKSAAEALNVITLVTS… |
| A0A0R3T4P2 | 5-228 | None |
| A0A5J4VT16 | 11-157 | None |
| A0A1D6GIQ8 | 3-217 | None |
| A0A5J4Z9M5 | 11-173 | None |
| A0A5J4Z1Q5 | 77-279 | None |
| A0A6J5VS59 | 313-559 | None |
| A0A6P8HUW0 | 5-167 | None |
| A0A2B4SJZ7 | 60-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.