DPCstruct | MC54230
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 459 ± 82 aa |
| Standard deviation of domain lengths | 81.96 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 12.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06597 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1Y1U3 | 9-421 | EYDIVLSVTQGTLNNQLRNMWLRRDQLAFPKTWDNESLRMDSIDDPSFKLNLDVPQLEILGQNDIRITFTFTEGSKLVLLKFNRSTK… |
| A0A6B4FVM3 | 170-530 | LSLLGWNTENSVSFRTMNEFIKKDNLYPKDFKAVYSYRKMTFTATGTFDSWEMTTGADGRNIRFKCPIKSAAYDLDGDVFNSSTENF… |
| A0A066X4U6 | 10-645 | None |
| A0A2S1JW71 | 119-508 | None |
| A0A3D8S4R6 | 12-522 | None |
| A0A7W8K4H3 | 288-790 | None |
| A1ZMC2 | 16-434 | None |
| A0A194XCU5 | 18-377 | None |
| G4T7M9 | 473-1012 | None |
| A0A7Y0JQ83 | 15-572 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.