DPCstruct | MC5423
Metacluster Properties and Pfam Annotations
| Number of structural domains | 108 |
|---|---|
| Mean domain length (aa) | 128 ± 23 aa |
| Standard deviation of domain lengths | 23.35 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02577 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C0U5N3 | 45-165 | NGYVPIKVEVNGNTVRIKYGCYAIDKNVLDGQALSIYHVINNITYFRPLTHDLIKDMLDLFEIKVKVAKIVDYRDGVYYARLVLERG… |
| A0A2A2YEY6 | 2-126 | PTPAGCAVFLGDGKKVISFFIDPSIGSSINAVLAGEKPERPLTHDLLLLTMDSFGAKLQRTVIVSMHEEIYYARVIFQVENELQEKK… |
| A0A7V1RD59 | 38-170 | None |
| A0A4Q3NT55 | 11-107 | None |
| A0A5C8KVN3 | 63-198 | None |
| A0A0A2DVK8 | 15-149 | None |
| M0ZVW0 | 136-252 | None |
| A0A0Q9NSU5 | 10-121 | None |
| A0A7G5GRJ2 | 1-98 | None |
| A0A7C3RQ71 | 30-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.