DPCstruct | MC54227
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 177 ± 22 aa |
| Standard deviation of domain lengths | 21.91 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 69.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10104 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1XZH4 | 116-289 | IASCSSGSDIEVLYSPKAKNRKLLNRDMPYVLSGWLQLAFNLFLVAITLYIIMQLIYTVQRDVDIKVKEYSQSILQEIEQCSKNYAE… |
| A0A1B7SFD6 | 117-292 | LSNSNLWQNLEPKQPQSAEKSTPKQSTFSKIVYSLLSDPQCASNLTLVVQILLNTLLFACFMTLVLFSFLAVKRDADRKIQGYSNKV… |
| S7WAV5 | 41-229 | None |
| A0A0F7SD46 | 3-153 | None |
| A0A1X2I4G5 | 19-170 | None |
| A0A4Q2CZW1 | 3-184 | None |
| A0A1Y2AL80 | 38-215 | None |
| A0A367JV17 | 522-723 | None |
| A0A367JUQ8 | 2-132 | None |
| A0A2H2ZXT7 | 89-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.