DPCstruct | MC54222
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 253 ± 18 aa |
| Standard deviation of domain lengths | 17.92 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1XTF8 | 1-252 | MFSFEGDFKAKRNINLGGSRQQQDKKDLLKKAQLERKKREQSRKRERSAILIQSFYRGRKRAQSLRSDLRQQWNAKFDDAKIADLTS… |
| I7GMF8 | 9-287 | RAWFIDRARQAREERLVQKERERAAVVIQAHVRSFLCRSRLQRDIRREIDDFFKADDPGSTKRSALCVFKIARKLLFVFRIKEDNER… |
| B7PS72 | 1-269 | None |
| F6SJB0 | 1-233 | None |
| A0A4U5N526 | 11-293 | None |
| A0A7J7UHS3 | 12-252 | None |
| A0A7R9FQE5 | 1-238 | None |
| A0A7J7P8H9 | 1-255 | None |
| A0A5K4F0J4 | 1-287 | None |
| A0A1I8GJJ6 | 1-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.