DPCstruct | MC54220
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 358 ± 81 aa |
| Standard deviation of domain lengths | 81.17 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 74.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04882 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A669ENI4 | 228-554 | GVYLLGKYAQIKFREIQEREATEYIAQARRQFHFESNQRTCNMTVLSMLPALKEAIVTQLNSESLTTLLKSKPANKLEIWEDLKIIS… |
| A0A1Y1XRE4 | 14-410 | RGFIITAGIIGGFYALGQYAKRKIVELQEKATRENIAKENLRRRFEQNQRDCLMTVLSLLPTLGEQMISEVNVEGSLAKLQQKRGVR… |
| Q18027 | 30-204 | None |
| D7KD37 | 2-288 | None |
| A0A2K8DPD5 | 30-414 | None |
| A0A7J6L7T5 | 131-500 | None |
| A0A7I4CBM1 | 15-275 | None |
| A0A317XLI1 | 306-739 | None |
| A0A3M7M8X1 | 148-632 | None |
| B7GEQ9 | 43-381 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.