DPCstruct | MC5422
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 108 ± 11 aa |
| Standard deviation of domain lengths | 11.06 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7S8M5 | 6-103 | RLRSIVIVGGGTAGWMTAAALGRFLTKDGQTRVTLVESDAIGTVGVGESTIPQINIFNRMLGLDENEFVRRTKATFKLAIEFRDWER… |
| A0A2A2YE27 | 1-107 | MSEQIQSILVLGGGSAGLIAAISLKRKIPHVNVTLLRSSDIGIIGVGEGTTPNFPAHMFDYLGIKRKTFFAIAKPTWKLGIRFLWGS… |
| A0A0A6D136 | 1-133 | None |
| A0A249PP23 | 5-105 | None |
| A0A5J6P1W8 | 2-104 | None |
| A0A0K2ZGY9 | 35-130 | None |
| A0A017HUU0 | 7-120 | None |
| A0A1E3UY32 | 1-114 | None |
| A0A7W4ZA89 | 1-98 | None |
| A5PC89 | 2-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.