DPCstruct | MC54218
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 73 ± 5 aa |
| Standard deviation of domain lengths | 5.41 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 48.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09783 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U9U9F0 | 45-117 | ISSVRLLPTTTCSLYSGSKFRGEQRSGRSSYDVSVHIQHVDLSESFLCGYLHIQGLTEDYPELTTFFEAEIIG |
| A0A1Y1X198 | 1-71 | MRQLSTGTRTLYPGSQFRGKQSSGAKDYEVVINLQHVDLEDSYLCGYLHIHNLTLEIPGLTTFFDTEVIRR |
| A0A1Y1LW02 | 2-84 | None |
| A0A0X3NMW1 | 12-82 | None |
| A0A183B0G5 | 1-67 | None |
| A0A151ZC60 | 291-357 | None |
| A0A6G0TA79 | 2-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.