DPCstruct | MC54216
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 588 ± 110 aa |
| Standard deviation of domain lengths | 110.30 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.01 |
| Pfam Score | 97.12 |
| Assigned Pfam label(s) | CL0020- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1WSV3 | 16-619 | SASAGEILAMVQIFNDCFRARTDAWNILQGSEAKFSSFFTRVLTLALPKHKGDDIEVRKEALIFLINCFQSLENPTIRAECMRIASL… |
| A0A1S3HH49 | 71-720 | PKIIDDIYQKEILGTKFAMRRTMMLEFSQYLENYLWPNFTEDKASRAHILTICVMVNEKFRERVPAWEAFQKFPDKFGGFFSRVMAT… |
| A0A842YSB2 | 2-417 | None |
| A0A6A6NF87 | 61-417 | None |
| A0A673KJU4 | 21-429 | None |
| A0A2C5X980 | 26-580 | None |
| A0A1E4T619 | 1-519 | None |
| A0A7J7JE19 | 91-677 | None |
| A0A7J6UC64 | 303-911 | None |
| A0A5K4F2S2 | 48-828 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.