DPCstruct | MC54215
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 91 ± 11 aa |
| Standard deviation of domain lengths | 10.85 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 74.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 48.96 |
| Pfam Score | 57.52 |
| Assigned Pfam label(s) | PF04503- CL0561 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M3Y644 | 2-74 | LALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDY |
| A0A1Y1VS14 | 1-86 | MSQPPTKSLWEGDKMLNTYIYDYCLKRNWTGAAQAFMNEAQVARDSQVPINSPNGFLYEWWVVFWDIFSARTNKTGSKDALSFVEV |
| A0A0F7S918 | 37-125 | None |
| A0A164Z4J2 | 1-73 | None |
| A0A164ZZX8 | 1-91 | None |
| A0A452TUR1 | 7-109 | None |
| A0A6P6RKC1 | 1-95 | None |
| A0A183WID4 | 4-90 | None |
| A0A6V7P005 | 22-123 | None |
| A0A5K3F362 | 1-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.