DPCstruct | MC54208
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 163 ± 12 aa |
| Standard deviation of domain lengths | 12.10 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A142XHX8 | 190-352 | DAHWENLMGTDRAKAAVAQRALLAAAPDHVAFIETQLGKLSIDKNERTRIRKLIEELDAESFDVRDAATDELVKLGAPAAEAVRALE… |
| A0A6M5YPB4 | 805-963 | GPADMGSAWKALADPDPKVGRAAVFRLADAPDLALRLFEERLKPAAPDPRAAALVQRLGADEFQEREAAEKELRALGTRAGPALAAA… |
| A0A7C4UW77 | 131-299 | None |
| A0A354GW40 | 4-144 | None |
| A0A354GN39 | 522-683 | None |
| A0A0S7YAZ5 | 221-393 | None |
| A0A5B9P722 | 313-507 | None |
| A0A5C1AKS2 | 15-170 | None |
| A0A177QIH2 | 680-833 | None |
| A0A7C4YJZ2 | 789-944 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.