DPCstruct | MC54207
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 99 ± 12 aa |
| Standard deviation of domain lengths | 11.73 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C3BMN7 | 6-110 | MDESIYKYPESYERLVELDLVNFDIWFLMESEQATNIYYGMKKRYPNRKLIPFAKRVDNDDIACFEIGKGSKVQLIHDFASEGFEQR… |
| A0A142XCB1 | 23-135 | PTDYRWLRAHGFRGFTPWHCLDAADRADKLRREFLTEVDGGSIPVQDFLPFAETQHMDEVAGFVVANGVATVQVCVVHLTWRGRAEA… |
| A0A6A8AFG7 | 233-335 | None |
| A0A1P8W923 | 147-242 | None |
| A0A1C4C150 | 2-110 | None |
| A0A3P3WDB0 | 180-279 | None |
| A0A286ESL6 | 160-258 | None |
| A0A518E4Y7 | 45-135 | None |
| A0A5C5XFQ8 | 111-210 | None |
| A0A0M9XDM4 | 2-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.