DPCstruct | MC54200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 130 ± 20 aa |
| Standard deviation of domain lengths | 20.09 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 34.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835NMS9 | 1-102 | MDCHQYTNRSCEECLKNVTCLWCASSRRCMEYPVRRILPPADLCELRSARWGVCWDKDDERAAREREKRRVRQEERRAEMKSRHDEI… |
| A0A3B5B0A0 | 31-146 | ECQSTPAPPRRKVDPCVLSAQCLWCFTTNNCTEYPVSWLLPPASVCQLSQARWGVCWLNFEALIIALAVVGGTILISIIACCCCCCC… |
| A0A0V0TWL5 | 2-107 | None |
| A0A0M3I5A2 | 23-173 | None |
| L5JYJ2 | 138-267 | None |
| A0A3B4ADJ6 | 6-114 | None |
| A0A3P7EIR7 | 11-172 | None |
| A0A822C3N7 | 13-129 | None |
| A0A183UF91 | 17-140 | None |
| A0A5N5PEA5 | 14-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.