DPCstruct | MC5420
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 167 ± 12 aa |
| Standard deviation of domain lengths | 12.35 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 68.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J5WMK0 | 42-184 | HIKVGSYYEMDHSKLPPRTTPEQLKAVRVVMVSEKGALKVALRFPSIHSLHTHITEGGYAKPLAKQIPALNEKYVMPAEMASEVLYR… |
| M5WK16 | 3-155 | IEVGGFYQVDQYKLLPSITPTQLEGARVVMVSEIDRHTVCVACPSIHTLHAHITEQGYQFGNLIPALDARYVMTPQVAAKVFFGRIP… |
| A0A2P6RSB1 | 34-201 | None |
| A0A7I8J6X1 | 1-168 | None |
| A0A5E4EAW1 | 42-208 | None |
| D7SSS7 | 5-188 | None |
| A0A3N6RFR2 | 21-193 | None |
| M5X8H6 | 5-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.