DPCstruct | MC542
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 278 ± 31 aa |
| Standard deviation of domain lengths | 31.06 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A4U4Q5 | 3-288 | VAFVASVLADADGIRWLSLSSVLRDLAEAAPKAFLDAVQASLAKPDKPVTRLIEETSSSSTFGQCWHADLLWALETLAWAPQHLLRV… |
| A0A250F0V3 | 23-260 | DSEIARPLVDSFANQFKYMGHNAKARNMLNELLGVNSPFETAEVIKTEMGSRLFRSFVEVNPKAVSECLWNIIGIIDIDSLKNIKEG… |
| A0A7W9R9S9 | 808-1072 | None |
| A0A5E6N9Z8 | 163-444 | None |
| A0A6S5PI43 | 99-350 | None |
| A0A378AM10 | 424-680 | None |
| A0A1Q8BA95 | 491-793 | None |
| A0A7D5NAZ5 | 1-220 | None |
| A0A2I8EZF8 | 472-801 | None |
| A0A5S3VFE1 | 157-459 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.