DPCstruct | MC54198
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 166 ± 25 aa |
| Standard deviation of domain lengths | 24.62 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 32.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A426ZEJ0 | 1-134 | MDRPQSSERGPVVAIECVAGSSKAEEWGGNMLQTGDVVEEIKIGGSPAVHSPFKGGRSGVQKLLHSAFKRGDTSIDVRVQRCGGEAA… |
| A0A2U1M8U8 | 1-140 | MKSNEMSYSQRLVCVKQVKQEAVEEWDDSMPLPGDIIEGIAPADGCTLEGVEDKFFVPTKGKSELRSLLGRISKRNADGFVWLKIRR… |
| A0A2I0JS36 | 75-258 | None |
| A0A6P4C0D7 | 41-193 | None |
| A0A3S3N064 | 1-148 | None |
| A0A3S3M9J5 | 20-149 | None |
| A0A067GDL3 | 1-143 | None |
| A0A4P1RDE0 | 8-164 | None |
| A0A059CM47 | 15-221 | None |
| A0A1S4DZB9 | 2-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.