DPCstruct | MC54194
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 85 ± 1 aa |
| Standard deviation of domain lengths | 1.28 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 93.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.97 |
| Mean intra-cluster sequence similarity (%) | 68.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B0MPD6 | 35-115 | HRYEALYANLLPQSMLGEVFLEKYVDHGDTVTVIDKKRTYSVTAAAKHPVYENFRVKAFKALLTSASSNEQLTALGELLYQ |
| A0A5D3CTV5 | 52-136 | HRYEAMYAKQLPETITGEAFMEQYSDHNDTVTVIDPKRVYGVRASARHPIYENFRVKAFKALLTSATSEDQLTSLGELLYQCHYS |
| A0A2J7ZLT5 | 92-176 | None |
| A0A484K4H5 | 224-308 | None |
| A0A835J0A3 | 233-316 | None |
| A0A5D2Q3Q3 | 581-665 | None |
| A0A166J8Q2 | 1011-1095 | None |
| A0A453NA80 | 167-252 | None |
| A0A1S4D2Y3 | 171-255 | None |
| A0A1U7VD01 | 358-442 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.