DPCstruct | MC54193
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 61 ± 5 aa |
| Standard deviation of domain lengths | 4.63 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 75.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A426Z210 | 1-60 | MEGRNCYADEHYLPTLFHMVDPGGIANWSVTHVDWSEGKWHPKAYRARDVTVDLLKNIIV |
| A0A5J4ZZ66 | 683-740 | MDGRNCYSDEHYLPTFFHMLDPAGIANWSVTHVDWSEGKWHPKSYTAQDITYDLIRNI |
| A0A453SNS6 | 67-127 | None |
| A0A287TSA6 | 1-71 | None |
| A0A2U1MJN4 | 278-336 | None |
| A0A3L6RLC2 | 234-290 | None |
| A0A834WRV4 | 48-103 | None |
| T1MRH4 | 246-311 | None |
| A0A835DKV8 | 1-70 | None |
| A0A7J0E2N4 | 1-60 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.