DPCstruct | MC54183
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 76 ± 11 aa |
| Standard deviation of domain lengths | 11.10 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 38.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02609 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P8YYP0 | 3-80 | TQKNENIKFEEALEKLEKIIAKLQEGNLNLDDSLKFYEEGIGLVRVCQQKLDTAESKITMLVNEGSADKKEVPFTMEA |
| A0A1J0W358 | 2-61 | AEIAAFGYERARDELINVVKMLEQGGLDLDDSLALWERGEALAARCEQHLAGARRRVEDA |
| A0A538SD29 | 11-92 | None |
| A0A7C2RS81 | 1-86 | None |
| A0A518AKG0 | 8-103 | None |
| A0A0D4BZR7 | 3-69 | None |
| V5BLD4 | 25-97 | None |
| A0A6F8T807 | 4-76 | None |
| A0A2V8WV43 | 1-74 | None |
| A0A1F1ZTC3 | 1-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.