DPCstruct | MC54181
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 65 ± 7 aa |
| Standard deviation of domain lengths | 6.85 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 47.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05183 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7N3N6 | 111-169 | DVIGGCDTNGSAYVFSDGVGTISIDFARTIALDLGVENFIPSCFQVRYRGVKGVLTLDP |
| J9DKJ4 | 20-79 | DIIGGRDTNQASYTFSDGVGKVSKEFAEKIAFDIGLGTSVPSCYQIRHRGIKGVLSVDPN |
| A0A3P6FW87 | 19-83 | None |
| A0A3P6FI95 | 37-109 | None |
| A0A5C7IQ94 | 480-555 | None |
| A0A0M3KDR2 | 135-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.