DPCstruct | MC5418
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 94 ± 10 aa |
| Standard deviation of domain lengths | 9.61 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 66.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 56.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01693 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A445CJM0 | 64-155 | GRKKKVVEPEPVASVMEHEEKVTFFVVRKGDIVGVYDTLVDCQSQVGSSVCDPPVSMYKGYSLSKDTQNYLVSRGLKNALYTIRAAD… |
| A0A7J9JUS4 | 1-84 | MENEKDAFFVVRKGDVVGVFKSFADCQTQVGSSICDPPVSVYKGYALRKETEIYLSSYGLKNARYTIRAADVKEDIFGALMPCP |
| A0A438JNY9 | 12-115 | None |
| A0A0K9RG49 | 151-247 | None |
| A0A835IYG7 | 75-171 | None |
| A0A396HDJ8 | 5-91 | None |
| A0A803QM03 | 1-89 | None |
| A0A835A788 | 47-149 | None |
| A0A843V6T8 | 80-197 | None |
| A0A438EHL3 | 17-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.