DPCstruct | MC54176
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 116 ± 15 aa |
| Standard deviation of domain lengths | 15.45 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A314ZUV1 | 1-120 | MHDKEFETLKEISSLRRLKISWAVASLKEVPPWLNPRQLTNIKKLYIRGGELCSLDHAGDETVTECKWRVEILRLKYMSNMKIELPK… |
| A5AVN5 | 116-223 | PQQLHELSLRFYPGKMNPGWLNPFSLPILRYLSISSGNLTNMSQRFWGDGDNTWKIEGLMLESLSDLGMEWSMVQQVMPRLRIVNVS… |
| A0A6J5UHP2 | 1-121 | None |
| A0A835LCJ2 | 479-583 | None |
| A0A565CFS4 | 102-220 | None |
| A0A2N9IFS3 | 425-557 | None |
| Q0JG25 | 215-317 | None |
| A0A7J6WAB5 | 146-245 | None |
| A0A2N9E1A1 | 611-721 | None |
| A0A0E0KS72 | 792-906 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.