DPCstruct | MC54175
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 157 ± 21 aa |
| Standard deviation of domain lengths | 20.97 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 72.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P6EJJ5 | 46-201 | CLIREELVIGHECPIALTYQMPDRMLHGIPSNSQPANIVTSDDVEFLMSVQEWTNGVQLCNTYGARNVAKYQFLCRTSFNIGDVKYL… |
| A0A816U970 | 1-132 | MLEPDGTRRPPITVSTTSEVEAMMHLRSWFTDLKICISSGYEDVGHFQFLNNTKFTVGGATFVFNGYLKKCFNVYNDFHELVASKDV… |
| A0A817BH78 | 46-232 | None |
| A0A087G3M6 | 3-171 | None |
| A0A816IM22 | 17-182 | None |
| A0A816L7T2 | 1-155 | None |
| A0A0D3CEQ2 | 46-231 | None |
| A0A3N6QNF8 | 1-116 | None |
| M4F794 | 239-368 | None |
| A0A3N6QVX2 | 46-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.