DPCstruct | MC54170
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 99 ± 8 aa |
| Standard deviation of domain lengths | 7.87 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y3EV97 | 164-251 | KKIVLLLAGINLIGISFSRSLHYQFYVWYYHLLPFLSWQTPYSTTSKLTLLGIIEMCWNVYPSTLWSSLLLHFCHAILLVGLFLQPDL |
| A0A178VRC6 | 19-119 | VSASRIITKEHVVTAMFVGNFIGIVFARSLHYQFYSWYFYSLPYLLWRTPFPTWLRLIMFLGIELCWNVYPSTPSSSGLLLCLHLII… |
| A0A4E0RQ78 | 52-150 | None |
| A0A183P5J2 | 10-102 | None |
| A0A397D5T2 | 3-104 | None |
| A0A6I9YNM2 | 101-206 | None |
| A0A5N4A2J3 | 867-944 | None |
| A0A0X3NFS6 | 107-212 | None |
| A0A811WC80 | 179-279 | None |
| A0A1B0GPR2 | 118-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.