DPCstruct | MC5417
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 194 ± 29 aa |
| Standard deviation of domain lengths | 29.43 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D8R3T2 | 399-611 | SSIMDLPDELWQRVILGAVERSRLDYRDVCLISMACRALRRVSELDCIWRLLWDQELGSSSSMTEGETAVAWKRRFATRYGRIKLSR… |
| M5WCZ2 | 1-201 | MSALPEELWRRILEIGVQRRGVSYKDLCCLSISSRRLHRLCDEDFLWSHLLSSDFPPFFSPSSSSITSAHSSSCKYLYKLRYERDRD… |
| A0A0D9V727 | 1-218 | None |
| A0A835IUV9 | 15-156 | None |
| A0A6P5G791 | 1-178 | None |
| A0A833VC77 | 1-135 | None |
| A0A4S4DCH3 | 1-197 | None |
| A0A835IWG6 | 1-183 | None |
| A0A0D2MMD3 | 1-195 | None |
| A0A446Q356 | 1-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.