DPCstruct | MC54169
Metacluster Properties and Pfam Annotations
| Number of structural domains | 402 |
|---|---|
| Mean domain length (aa) | 159 ± 29 aa |
| Standard deviation of domain lengths | 28.80 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.11 |
| Pfam Score | 99.38 |
| Assigned Pfam label(s) | CL0020- CL0214- CL0280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q6L282 | 3-123 | YIIDGSNVAFGSGRPLAENISNMIRYLKKHGIENIIVICDASLRYKIIDKDHFENLVNLNIIKIAPAGTSADEFIIEYAKKNDAMII… |
| A0A178V2R5 | 10-161 | YEAILDGANIGLYQQNFADGGFSLPQLEAVVKELYNKSGSKKQPLILLHKKRVNALLENPNHRNLVEEWINNNVLYATPPGSNDDWY… |
| A0A7S4L3L8 | 262-458 | None |
| A0A6V7WAF6 | 26-177 | None |
| Q7XK95 | 179-337 | None |
| M4DAR2 | 836-996 | None |
| A0A0M3IGL5 | 1-185 | None |
| I3T310 | 141-305 | None |
| A0A1V9Z6K8 | 3-169 | None |
| A0A6L6C6B4 | 3-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.