DPCstruct | MC54165
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 104 ± 13 aa |
| Standard deviation of domain lengths | 12.64 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A395Z6M0 | 1-121 | MIYDESIIKEDIKKLEAREFYIKYIIKTNNWYFAEYQHTEGNELIDKMDRFKEIVSDCFEVSFHSAQIVGSAKLGMSLSPQKPFRHF… |
| B1C939 | 4-106 | KEKLENDLKNKEISDLSIVEKYICFGVPIIFKNNEERYYELLQDLRNHFTLNSMRNIIIVGSSKLGFSIAPGKRFKDISDDSDIDVA… |
| A0A7C6FGP0 | 1-126 | None |
| A0A1I7JC67 | 8-106 | None |
| A0A6N2E1V4 | 25-119 | None |
| A0A7U0G0E7 | 1-118 | None |
| F9UI81 | 69-152 | None |
| A0A811TH02 | 3-108 | None |
| A0A329XIZ6 | 2-96 | None |
| A0A1S8CUR5 | 1-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.