DPCstruct | MC54161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 97 ± 14 aa |
| Standard deviation of domain lengths | 13.50 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6DLK5 | 255-350 | LMKVHGGTTSADIFRQVKKAEDIARTNAEIIREHKNLHTFKHMDTVLFFDEANTTEAIGAIKEIMCDKTLKGRPIEIHQRLIKIVAA… |
| A0A7D9JXM5 | 101-211 | MGETGCGKTRLIRFMCELQAGPDGPKNLVLMKIHGGTTYTEIEKKVEEAEKYASCYEGINVDTILFFDEANTTDAVDLIKEIMVDRR… |
| X6LAG9 | 142-246 | None |
| A0A815TI05 | 19-107 | None |
| A0A2N0QS22 | 2-78 | None |
| A0A8B6GML0 | 134-212 | None |
| X6N9K1 | 197-313 | None |
| A0A140D068 | 319-418 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.