DPCstruct | MC5416
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 186 ± 20 aa |
| Standard deviation of domain lengths | 19.71 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R6W5U7 | 149-332 | VDRGTNGGPRPASWEDFYSIDWMPKEFFLKFRQQVEGYQLGANFEFDGFKVNGCNTKIVFKPAKADRKWKFICEPKHGDFRLLTKKI… |
| M5W9J6 | 4-182 | GSNGEEPTSWEELYSINLIPSELFLKFRKEVQGLRVGLNLEFYNAPCNEFQGKLVLKPLAPERMWKFIYEPIHQDVRILSKKIPLTG… |
| A0A059CVM6 | 7-155 | None |
| A0A2H5NDC0 | 2-156 | None |
| A0A7G2E986 | 208-396 | None |
| A0A6J5VQF5 | 5-183 | None |
| A0A2V3IVH0 | 31-228 | None |
| A0A5B8MKE3 | 5-183 | None |
| C1N2G6 | 1-231 | None |
| A0A7J6EYS9 | 45-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.