DPCstruct | MC54154
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 129 ± 14 aa |
| Standard deviation of domain lengths | 13.74 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H5CE35 | 1-119 | MLTHQWGRELRKSGYRTTVAVRFRVPDDEPVTVSHYNRKPVSMTAAKAAALIRAHPDPRGYEVFLPRAVRAAEIHDVRHVSGVTGWR… |
| M6KJR0 | 38-175 | MPVIPDFWITHQWLREIKRFSNGPVIGVYFKIPDLEPVWSGNYTSKLILSSVIESTQLLLSTENKLGFQIVLPRKVTKKEILKIKNL… |
| A0A6G4QTD6 | 33-186 | None |
| A0A1R3UIE8 | 86-188 | None |
| A0A1H5HAV1 | 33-158 | None |
| D6U153 | 34-166 | None |
| A0A4R6YSN2 | 62-190 | None |
| A0A6I1JWP3 | 1-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.