DPCstruct | MC54152
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 84 ± 4 aa |
| Standard deviation of domain lengths | 4.16 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 33.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9AJC4 | 1-87 | MAHTQLAHFYNVPSGGYIGLTNAHSNDAQSGYETGMNTTAALLAGSDMFNMGGLLSSLMVFDFSKAVIDNEIALMLKRIMKGLALSK |
| A0A497AUT4 | 141-226 | AHAQLARHYGLPSRSGGALTDASYPDAQAGFESMLALLTTINSGVDFVLHAGGILSSYLAFSYEKFVLDDEMCGMVRRLQRGIEVT |
| A0A0J1FGZ2 | 66-151 | None |
| A0A1F8SWR1 | 2-82 | None |
| A0A7J3BF04 | 1-73 | None |
| A0A645EB16 | 19-105 | None |
| A0A0S8KPT8 | 1-82 | None |
| A0A388Q9V4 | 97-183 | None |
| A0A7X6NVM8 | 148-225 | None |
| A0A0F9DVZ0 | 16-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.