DPCstruct | MC54150
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 105 ± 17 aa |
| Standard deviation of domain lengths | 17.02 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9AAI8 | 1-119 | MNLNDQIQAWRHAAEGELLPCPFCGGKAELGDGRFHDWKVECEECFVEVTHLERDAVINLWNTRTPAVPALCDALEVTEDMFIDVLI… |
| A0A1H3G104 | 1-111 | MTKNTTAPELLPCPFCGGKAKWISGGPGCTYISCMACPAATDDGAVPRIAKAWNTRADLHAARVAELEIALSEMRRDRDVRKQSAYE… |
| A0A7W7NG40 | 1-131 | None |
| A0A2D9CAQ2 | 16-105 | None |
| A0A132HM36 | 10-103 | None |
| A0A7Y7ZCW2 | 1-112 | None |
| A0A514B5R8 | 1-106 | None |
| A0A2U2BHE2 | 3-81 | None |
| A0A0F9MIY2 | 1-87 | None |
| A0A2A5AYA2 | 4-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.