DPCstruct | MC5415
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 95 ± 11 aa |
| Standard deviation of domain lengths | 11.10 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 41.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0622 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1KF24 | 13-106 | VVVVEGGTKQQKKYKKLMQHRIKWEEDIVKDPDGNEVPNKCVLVWEGTSKQRNFGEVKFKACPTERLAREYFKKHKVEHYWDLAYSN… |
| M5W477 | 6-93 | VGGGSESIKRYAKVMLRRVNWAEAVKDEEEVDDDVNNDKPANKCVLVWQGSVARPSFNRYSVHECMTEAAARKIFADAGVAHYWDLEV |
| S7MTZ3 | 2-94 | None |
| A0A7J6WCZ1 | 1-72 | None |
| X6MPA5 | 1-88 | None |
| A0A7R9AD73 | 499-587 | None |
| A0A0V1A0Y6 | 931-1034 | None |
| A0A2W1BCC5 | 1-77 | None |
| A0A6D2LGU3 | 865-964 | None |
| A0A7S1SMC0 | 361-448 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.