DPCstruct | MC54148
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 153 ± 29 aa |
| Standard deviation of domain lengths | 29.28 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17248 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9A568 | 11-171 | KFRLRFGWLALVALLAQIIVMYVGFGEAEVLRRFVFSATYVLLLAFVVLNWRRVGIVLVGVGMLLNFLAIVTNGGLMPISPAAMEKA… |
| A0A536JTP8 | 9-122 | FLGELAFSASVAGLALVAFVALVNRGMPGAWLVGLGSLLNAAVTLINGGMPVDPGALAISGKAAPSDGLHVILGPATRLPFLADVLL… |
| A0A4R1DC14 | 4-188 | None |
| A0A1F8F804 | 3-107 | None |
| A0A6I2WD59 | 35-208 | None |
| F2NQQ3 | 18-172 | None |
| A0A7V9ZJ68 | 4-150 | None |
| A0A645JA53 | 27-141 | None |
| A0A838SP62 | 10-176 | None |
| A0A1G7CVC2 | 16-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.