DPCstruct | MC54143
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 168 ± 25 aa |
| Standard deviation of domain lengths | 25.04 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 19.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2E5J2 | 4-171 | QKTINAQVISANRQKWINDFRDNIAEFCLLMFNHYDARSGYLITERKLRVITDIYKGTNYSEDFRARYQDASDEFASCLERSQLTHN… |
| V6SQ35 | 5-148 | EIDLNIVITILTSILIPIIIGFITYIIAKKQIINTGVTQFRQQWINSLRDTISVFISRAEYTSIQENQEKIKEAFREIVEAEFKIEL… |
| A0A842HS43 | 16-190 | None |
| A0A6A2SZ11 | 7-168 | None |
| A0A1S1Y5G0 | 5-155 | None |
| A0A011QI50 | 1-179 | None |
| A0A5P3MI08 | 27-232 | None |
| A0A0F6II55 | 30-207 | None |
| V8CMB6 | 1-192 | None |
| A0A7J4VSZ4 | 6-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.