DPCstruct | MC54140
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 135 ± 23 aa |
| Standard deviation of domain lengths | 23.26 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 16.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0291 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J4F9N0 | 91-216 | RVSREETIRLTETYVKQSLLYLDNARDEIERQEYEKASEFLWGSVAEALKAVLMVRKGLRIKSHGEFWSLARELAKELGDEGVYTTF… |
| A0A2H9MPR2 | 18-140 | PSIEMIKKEIKNAEYDLARSKESLSKKDYKWASIQAYYSMFHSAKALVLNKGYREKSHYCLLVALRELYIKTDELDKESADDFEMCM… |
| A0A7C7QQ33 | 60-187 | None |
| A0A2G4YRW1 | 112-299 | None |
| A0A1V4WNF8 | 274-424 | None |
| A0A1M5GBM9 | 580-693 | None |
| F0NGN9 | 1-121 | None |
| A0A7Y4XP72 | 119-282 | None |
| A0A2G4YT60 | 135-292 | None |
| A0A7Y2GQ63 | 120-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.