DPCstruct | MC5414
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 75 ± 10 aa |
| Standard deviation of domain lengths | 10.35 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 27.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S0VW79 | 6-77 | RELETIALTQASWRVCDARLPDDDGTRLLAYVEQIDDHVETLWMWPNAGECTTTASLDLALSAILERLLARR |
| A0A6L9Y394 | 4-80 | RTEPVPIDLVPVHPGAWRACDARFAYNDAQSLVGFVEDVGDEVEVMVIGDRFSWAFFPTLTDAVEFLRAVAAELTVQ |
| A0A1H4N1Y9 | 13-83 | None |
| A0A160KPT6 | 5-75 | None |
| A0A2S5VH64 | 7-86 | None |
| A0A7H4GUR4 | 1-94 | None |
| A0A2V1HQH7 | 3-68 | None |
| A0A5C8UL26 | 2-71 | None |
| A0A2W0DRK5 | 24-87 | None |
| A0A2A9DWD6 | 23-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.