DPCstruct | MC54132
Metacluster Properties and Pfam Annotations
| Number of structural domains | 453 |
|---|---|
| Mean domain length (aa) | 122 ± 25 aa |
| Standard deviation of domain lengths | 25.27 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.35 |
| Pfam Score | 46.48 |
| Assigned Pfam label(s) | CL0123- CL0375- CL0219- CL0331- PF05344 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W8PLN9 | 15-124 | ATPEEIIVMKASAIAPPRCPDCGSTSLVRIGGVIKANGLRVQRFRCRVCGRTFTELEGTPLKGLHDIRFALVVAYLFLCLGMEPKII… |
| A0A840EE63 | 10-126 | EADCAETWRQPRWPEEGPECPDCGSTEIQTRQKNRRNCFHRYCCRSCGRWFTDTTDTFLEASGARLSRWVYLIREMDKKCSINDIAK… |
| A0A1Y6F8L0 | 22-160 | None |
| A0A351I9R2 | 4-116 | None |
| A0A413CVN3 | 38-162 | None |
| A0A1Y1N6I3 | 1-162 | None |
| A0A6B1BXG0 | 17-123 | None |
| A0A5S6QDA4 | 7-141 | None |
| A0A5S6QQJ5 | 3-150 | None |
| A0A4Q1VYN6 | 1-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.