DPCstruct | MC5413
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 67 ± 4 aa |
| Standard deviation of domain lengths | 3.89 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 44.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A654HC80 | 38-107 | SCAAALECYECSQVAGNTGPCTSTRRTCRVSQDACISFVQYRTPDFWTILSERRPFISKGCTSKMECASQ |
| A0A813V710 | 5-70 | CCNTVVNTLECYVCEQQEGNDDKCIKTVRMCQRHEDTCATLTLWTTPHEWTPRGERRHYISKGCDT |
| A0A177AWV0 | 6-66 | None |
| T1JK87 | 6-71 | None |
| A0A7R9QP74 | 1-66 | None |
| A0A812AS83 | 15-90 | None |
| A0A1B0B9Q4 | 39-106 | None |
| A0A5N5THT9 | 59-123 | None |
| A0A7R8H1E3 | 308-379 | None |
| V9IHU1 | 14-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.