DPCstruct | MC54128
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 287 ± 39 aa |
| Standard deviation of domain lengths | 39.27 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 67.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 31.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9FLP4 | 1-309 | MTSSGRNDLQGSASDPLFPKKGSSGTSLESNNLRGNASIFVNSSVMLHDQLSSAASFALVDLVASVLRLDFWQNNDHLSDIEFCTQA… |
| S4RQK5 | 1-204 | PTRFARPPPTLPLPRPLAAAEPAETVGKTLSDTGRFSYAALCAISLASLLPTDNHSEFRQRFTTSLTEWLGLPATVLPIMEAFAEGT… |
| A0A6I9JM17 | 30-287 | None |
| F1L8S1 | 1-336 | None |
| A0A4U8US79 | 13-247 | None |
| A0A7J5ZEM9 | 78-355 | None |
| A0A3Q7Y619 | 2-273 | None |
| W4FZS0 | 21-343 | None |
| A0A0V1HE88 | 6-350 | None |
| A0A7M7NXH2 | 95-389 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.