DPCstruct | MC54127
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 90 ± 9 aa |
| Standard deviation of domain lengths | 8.84 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.68 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9FB40 | 1-100 | MKPAIEVEEKFPDENYDVRIEKGNIPKPNKALFNPDSPIYKSGDENQPGEGGKAVIIDRNKLTLDERRIYDDGFTKNAFNQYISDMI… |
| A0A183T2J7 | 128-229 | MNIQKPGPKLVDETVDDTPPGLHPLTPPIQSGPSATGPGEHGNAVKIDKDTLSPEERAKYETGEKNNAFNEYASNMISVRRHLPDIR… |
| A0A183RE53 | 128-225 | None |
| A0A6J8EUX7 | 76-150 | None |
| A0A1A9Z4E9 | 178-270 | None |
| A0A0J7L444 | 72-160 | None |
| A0A016UZL6 | 3-90 | None |
| A0A4Y2FSF8 | 98-181 | None |
| F4X0D5 | 77-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.