DPCstruct | MC54125
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 276 ± 35 aa |
| Standard deviation of domain lengths | 34.75 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.53 |
| Pfam Score | 98.41 |
| Assigned Pfam label(s) | CL0257- PF06466 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9EUM9 | 10-282 | LDEKSWKKLAMHTRCSLCHCRGWKLMCDSENPFVITSAFLDDVLFSTPCETCRHSLGRHLDRLREKKRNDVRKLLFMMSDAEKMQER… |
| A0A6P8H9H9 | 49-342 | SFTRRKKLEKLGVYSSCKAEESCKCNGWKNPNPPPTPPRLDLSQPLASLTDPCRSCNHPLGSHISHLQSLEEDELDRLLCMVVDVEN… |
| A0A0N1ISX5 | 20-362 | None |
| A0A6J3HZ28 | 96-388 | None |
| A0A834JN25 | 31-368 | None |
| A0A4Z2BL48 | 14-303 | None |
| A0A6H5GZS4 | 2-266 | None |
| B7PUT4 | 43-309 | None |
| A0A090LK47 | 35-290 | None |
| A0A183VLG5 | 13-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.